Ray Lago - Desert Lifestyle Properties Logo
  • (760) 317-6144
  • Home
  • Search
  • About Me
  • My Portal
  • Home Valuation
  • Contact Me

Property Links

Joshua Tree, CA

Domain Name Street Address
1millielane.desertlifestyleproperties.com 1 Millie Lane, Joshua Tree, CA, 92252
4869avenidalamanana.desertlifestyleproperties.com 4869 Avenida La Manana, Joshua Tree, CA, 92252
61665divisionstreet.desertlifestyleproperties.com 61665 Division Street, Joshua Tree, CA, 92252

Rancho Mirage, CA

Domain Name Street Address
34071deniseway.desertlifestyleproperties.com 34071 Denise Way, Rancho Mirage, CA, 92270
40shorelinedrive.desertlifestyleproperties.com 40 Shoreline Drive, Rancho Mirage, CA, 92270
45lincolnplace.desertlifestyleproperties.com 45 Lincoln Place, Rancho Mirage, CA, 92270
4marseillesroad.desertlifestyleproperties.com 4 Marseilles Road, Rancho Mirage, CA, 92270
71138patriciaparkplace.desertlifestyleproperties.com 71138 Patricia Park Place, Rancho Mirage, CA, 92270

Yucca Valley, CA

Domain Name Street Address
1avalonavenue.desertlifestyleproperties.com 1 Avalon Avenue, Yucca Valley, CA, 92284
3715surrey.desertlifestyleproperties.com 3715 Surrey, Yucca Valley, CA, 92284
57885eldoradodrive.desertlifestyleproperties.com 57885 El Dorado Drive, Yucca Valley, CA, 92284

29 Palms, CA

Domain Name Street Address
0amboyroad.desertlifestyleproperties.com 0 Amboy Road, 29 Palms, CA, 92277
10nevadatrail.desertlifestyleproperties.com 10 Nevada Trail, 29 Palms, CA, 92277
1gorgoniodrive.desertlifestyleproperties.com 1 Gorgonio Drive, 29 Palms, CA, 92277

Indio, CA

Domain Name Street Address
81331cortecompras.desertlifestyleproperties.com 81331 Corte Compras, Indio, CA, 92203
84136avenue44546.desertlifestyleproperties.com 84136 Avenue 44 546, Indio, CA, 92203
84136avenue44549.desertlifestyleproperties.com 84136 Avenue 44 549, Indio, CA, 92203

La Quinta, CA

Domain Name Street Address
79185canterracircle.desertlifestyleproperties.com 79185 Canterra Circle, La Quinta, CA, 92253

Cathedral City, CA

Domain Name Street Address
174coyote.desertlifestyleproperties.com 174 Coyote, Cathedral City, CA, 92234
28851avenidadiosa.desertlifestyleproperties.com 28851 Avenida Diosa, Cathedral City, CA, 92234
2sandcreek.desertlifestyleproperties.com 2 Sand Creek, Cathedral City, CA, 92234
30005avenidaalvera.desertlifestyleproperties.com 30005 Avenida Alvera, Cathedral City, CA, 92234
30275avenidajuarez.desertlifestyleproperties.com 30275 Avenida Juarez, Cathedral City, CA, 92234
35329vistamontanacourt.desertlifestyleproperties.com 35329 Vista Montana Court, Cathedral City, CA, 92234
396spaseolaredo.desertlifestyleproperties.com 396 S Paseo Laredo, Cathedral City, CA, 92234
493prairie.desertlifestyleproperties.com 493 Prairie, Cathedral City, CA, 92234
67795medanoroad.desertlifestyleproperties.com 67795 Medano Road, Cathedral City, CA, 92234
69411ramonrd131.desertlifestyleproperties.com 69411 Ramon Rd 131, Cathedral City, CA, 92234
69411ramonrd269.desertlifestyleproperties.com 69411 Ramon Rd 269, Cathedral City, CA, 92234
69411ramonrd359.desertlifestyleproperties.com 69411 Ramon Rd #359, Cathedral City, CA, 92234
69411ramonrd39.desertlifestyleproperties.com 69411 Ramon Rd 39, Cathedral City, CA, 92234
69411ramonrd562.desertlifestyleproperties.com 69411 Ramon Rd 562, Cathedral City, CA, 92234
69411ramonrd604.desertlifestyleproperties.com 69411 Ramon Rd #604, Cathedral City, CA, 92234
69411ramonrd683.desertlifestyleproperties.com 69411 Ramon Rd 683, Cathedral City, CA, 92234
69411ramonrd776.desertlifestyleproperties.com 69411 Ramon Rd 776, Cathedral City, CA, 92234
69411ramonrd788.desertlifestyleproperties.com 69411 Ramon Rd 788, Cathedral City, CA, 92234
69411ramonrd839.desertlifestyleproperties.com 69411 Ramon Rd #839, Cathedral City, CA, 92234
69411ramonrd859.desertlifestyleproperties.com 69411 Ramon Rd #859, Cathedral City, CA, 92234
69411ramonrd880.desertlifestyleproperties.com 69411 Ramon Rd 880, Cathedral City, CA, 92234
69411ramonroad145.desertlifestyleproperties.com 69411 Ramon Road 145, Cathedral City, CA, 92234
69411ramonroad224.desertlifestyleproperties.com 69411 Ramon Road 224, Cathedral City, CA, 92234
69411ramonroad243.desertlifestyleproperties.com 69411 Ramon Road 243, Cathedral City, CA, 92234
69411ramonroad277-1.desertlifestyleproperties.com 69411 Ramon Road 277, Cathedral City, CA, 92234
69411ramonroad277.desertlifestyleproperties.com 69411 Ramon Road 277, Cathedral City, CA, 92234
69411ramonroad41.desertlifestyleproperties.com 69411 Ramon Road 41, Cathedral City, CA, 92234
69411ramonroad42.desertlifestyleproperties.com 69411 Ramon Road 42, Cathedral City, CA, 92234
69411ramonroad427.desertlifestyleproperties.com 69411 Ramon Road 427, Cathedral City, CA, 92234
69411ramonroad463.desertlifestyleproperties.com 69411 Ramon Road 463, Cathedral City, CA, 92234
69411ramonroad48.desertlifestyleproperties.com 69411 Ramon Road 48, Cathedral City, CA, 92234
69411ramonroad663.desertlifestyleproperties.com 69411 Ramon Road 663, Cathedral City, CA, 92234
69411ramonroad758.desertlifestyleproperties.com 69411 Ramon Road 758, Cathedral City, CA, 92234
69801ramonrd82.desertlifestyleproperties.com 69801 Ramon Rd #82, Cathedral City, CA, 92234
7sandcreek.desertlifestyleproperties.com 7 Sand Creek, Cathedral City, CA, 92234
89sandcreek.desertlifestyleproperties.com 89 Sand Creek, Cathedral City, CA, 92234
96sandcreek.desertlifestyleproperties.com 96 Sand Creek, Cathedral City, CA, 92234

Palm Desert, CA

Domain Name Street Address
154wimbledoncourt.desertlifestyleproperties.com 154 Wimbledon Court, Palm Desert, CA, 92260
162wimbledoncourt.desertlifestyleproperties.com 162 Wimbledon Court, Palm Desert, CA, 92260
34countryclubdrive.desertlifestyleproperties.com 34 Country Club Drive, Palm Desert, CA, 92260
41728viatreviso.desertlifestyleproperties.com 41728 Via Treviso, Palm Desert, CA, 92260
72781elpaseo714.desertlifestyleproperties.com 72781 El Paseo 714, Palm Desert, CA, 92260

Palm Springs, CA

Domain Name Street Address
120vibeway.desertlifestyleproperties.com 120 Vibe Way, Palm Springs, CA, 92262
1409nsunriseway43.desertlifestyleproperties.com 1409 N Sunrise Way 43, Palm Springs, CA, 92262
1415nsunriseway49.desertlifestyleproperties.com 1415 N Sunrise Way 49, Palm Springs, CA, 92262
1555nchaparralroad.desertlifestyleproperties.com 1555 N Chaparral Road, Palm Springs, CA, 92262
1555nchaparralroad309-1.desertlifestyleproperties.com 1555 N Chaparral Road 309, Palm Springs, CA, 92262
1555nchaparralroad309.desertlifestyleproperties.com 1555 N Chaparral Road 309, Palm Springs, CA, 92262
1555nchaparralroad312.desertlifestyleproperties.com 1555 N Chaparral Road 312, Palm Springs, CA, 92262
1555nchaparralroad320.desertlifestyleproperties.com 1555 N Chaparral Road 320, Palm Springs, CA, 92262
1555nchaparralroad328.desertlifestyleproperties.com 1555 N Chaparral Road 328, Palm Springs, CA, 92262
179theriv.desertlifestyleproperties.com 179 The Riv, Palm Springs, CA, 92262
1870nmiralomaway.desertlifestyleproperties.com 1870 N Mira Loma Way, Palm Springs, CA, 92262
1875nicolaroad.desertlifestyleproperties.com 1875 Nicola Road, Palm Springs, CA, 92262
1881sarabydrive13.desertlifestyleproperties.com 1881 S Araby Drive 13, Palm Springs, CA, 92264
1881sarabydrive31.desertlifestyleproperties.com 1881 S Araby Drive #31, Palm Springs, CA, 92264
211newport.desertlifestyleproperties.com 211 Newport, Palm Springs, CA, 92264
2405ebellamyroad.desertlifestyleproperties.com 2405 E Bellamy Road, Palm Springs, CA, 92262
2622ngirasolavenue-1.desertlifestyleproperties.com 2622 N Girasol Avenue, Palm Springs, CA, 92262
2622ngirasolavenue.desertlifestyleproperties.com 2622 N Girasol Avenue, Palm Springs, CA, 92262
266eviaescuelad.desertlifestyleproperties.com 266 E Via Escuela D, Palm Springs, CA, 92262
2822nauburncourt210.desertlifestyleproperties.com 2822 N Auburn Court 210, Palm Springs, CA, 92262
307warenasroad.desertlifestyleproperties.com 307 W Arenas Road, Palm Springs, CA, 92262
385eviaescuela415.desertlifestyleproperties.com 385 E Via Escuela 415, Palm Springs, CA, 92262
415eavenidagranadaroad.desertlifestyleproperties.com 415 E Avenida Granada Road, Palm Springs, CA, 92264

Sky Valley, CA

Domain Name Street Address
018thavenue.desertlifestyleproperties.com 0 18th Avenue, Sky Valley, CA, 92241

Victorville, CA

Domain Name Street Address
0us395.desertlifestyleproperties.com 0 Us-395, Victorville, CA, 92392

Morongo Valley, CA

Domain Name Street Address
11002knobbavenue.desertlifestyleproperties.com 11002 Knobb Avenue, Morongo Valley, CA, 92256

Landers, CA

Domain Name Street Address
1388njemeztrail.desertlifestyleproperties.com 1388 N Jemez Trail, Landers, CA, 92285
1medinadrive.desertlifestyleproperties.com 1 Medina Drive, Landers, CA, 92285
1yetterslane.desertlifestyleproperties.com 1 Yetters Lane, Landers, CA, 92285

Bermuda Dunes, CA

Domain Name Street Address
79336montegobaydrive.desertlifestyleproperties.com 79336 Montego Bay Drive, Bermuda Dunes, CA, 92203

Desert Hot Springs, CA

Domain Name Street Address
07thstreetstreet.desertlifestyleproperties.com 0 7th Street Street, Desert Hot Springs, CA, 92240
0firststreet.desertlifestyleproperties.com 0 First Street, Desert Hot Springs, CA, 92240

Ray Lago - Desert Lifestyle Properties

  • Palm Springs Real Estate
  • •
  • State
  • •
  • County
  • •
  • City
  • •
  • Zip Code
  • •
  • Community
  • •
  • Area
  • Privacy
  • •
  • Accessibility
  • •
  • DMCA
  • •
  • ClientBAY Login
  • •
  • SitesBAY Login
  • Send us an email

Ray Lago  |    |  02007780
Desert Lifestyle Properties - 200 N Sunrise Way Ste.B, Palm Springs, CA 92262

MLS Internet Data Exchange (IDX) information is provided exclusively for consumers’ personal, non-commercial use and may not be used for any purpose other than to identify prospective properties consumers may be interested in purchasing, and that the data is deemed reliable but is not guaranteed accurate by the California Regional MLS.
POWERED BY
Real Estate Website by Back At You